2.20 Rating by ClearWebStats
antalyaenyakinlastikci.com is 4 years 11 months 3 weeks old. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, antalyaenyakinlastikci.com is SAFE to browse.
Get Custom Widget

Traffic Report of Antalyaenyakinlastikci

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
View antalyaenyakinlastikci.com site advisor rating Not Applicable

Where is antalyaenyakinlastikci.com server located?

Hosted IP Address:

143.95.225.99 View other site hosted with antalyaenyakinlastikci.com

Hosted Country:

antalyaenyakinlastikci.com hosted country US antalyaenyakinlastikci.com hosted country

Location Latitude:

34.0549

Location Longitude:

-118.2578

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View antalyaenyakinlastikci.com HTML resources

Homepage Links Analysis

Antalya En Yakın Lastikçi - 7/24 Mobil Lastikçi 0 542 611 69 87 Arayın

Website Inpage Analysis

H1 Headings: 3 H2 Headings: 1
H3 Headings: 3 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 31
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 143.95.225.99)

Antalya Adaklık Kurbanlık - 7/24 İletişim İçin 0553 402 0740

antalyaenyakinlastikci.com favicon - antalya-adaklikkurbanlik.com

View antalyaenyakinlastikci.com Pagerank   antalyaenyakinlastikci.com alexa rank Not Applicable   antalyaenyakinlastikci.com website value $ 8.95

Abdullah Saeed – All the latest article

antalyaenyakinlastikci.com favicon - abdullahblog.com

View antalyaenyakinlastikci.com Pagerank   antalyaenyakinlastikci.com alexa rank Not Applicable   antalyaenyakinlastikci.com website value $ 8.95

Index of /

antalyaenyakinlastikci.com favicon - spredtechnologies.com

View antalyaenyakinlastikci.com Pagerank   antalyaenyakinlastikci.com alexa rank Not Applicable   antalyaenyakinlastikci.com website value $ 8.95

Antalya Sepetli Vinç Kiralama - İletişim İçin : 0543 875 3833

antalyaenyakinlastikci.com favicon - antalyaenessepetlivinckiralama.com

View antalyaenyakinlastikci.com Pagerank   antalyaenyakinlastikci.com alexa rank Not Applicable   antalyaenyakinlastikci.com website value $ 8.95

KGN Travels - Coming Soon

antalyaenyakinlastikci.com favicon - kgntravels.lk

View antalyaenyakinlastikci.com Pagerank   antalyaenyakinlastikci.com alexa rank Not Applicable   antalyaenyakinlastikci.com website value $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx/1.16.0
Date: Sat, 25 May 2019 18:03:21 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Link: <http://antalyaenyakinlastikci.com/wp-json/>; rel="https://api.w.org/"
Content-Encoding: gzip

Domain Information for antalyaenyakinlastikci.com

Domain Registrar: FBS INC. antalyaenyakinlastikci.com registrar info
Registration Date: 2019-05-23 4 years 11 months 3 weeks ago
Last Modified: 2019-05-23 4 years 11 months 3 weeks ago

Domain Nameserver Information

Host IP Address Country
ns1.webserversystems.com antalyaenyakinlastikci.com name server information 162.214.130.211 antalyaenyakinlastikci.com server is located in United States United States
ns2.webserversystems.com antalyaenyakinlastikci.com name server information 162.214.129.93 antalyaenyakinlastikci.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
antalyaenyakinlastikci.com A 21599 IP:143.95.225.99
antalyaenyakinlastikci.com NS 21599 Target:ns1.webserversystems.com
antalyaenyakinlastikci.com NS 21599 Target:ns2.webserversystems.com
antalyaenyakinlastikci.com SOA 21599 MNAME:ns1.webserversystems.com
RNAME:info.antalyainternet.net
Serial:2019052302
Refresh:86400
Retry:7200
Expire:3600000
antalyaenyakinlastikci.com MX 21599 Target:mail.antalyaenyakinlastikci.com
antalyaenyakinlastikci.com TXT 21599 TXT:v=spf1 a mx include:websitewelcome.com
~all

Similarly Ranked Websites to Antalyaenyakinlastikci

Google

antalyaenyakinlastikci.com favicon - google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

View antalyaenyakinlastikci.com Pagerank   Alexa rank for antalyaenyakinlastikci.com 1   website value of antalyaenyakinlastikci.com $ 8,833,062,960.00

Google Calendar - Sign in to Access & Edit Your Schedule

antalyaenyakinlastikci.com favicon - calendar.google.com

Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).

View antalyaenyakinlastikci.com Pagerank   Alexa rank for antalyaenyakinlastikci.com 1   website value of antalyaenyakinlastikci.com $ 8,833,062,960.00

Gmail

antalyaenyakinlastikci.com favicon - mail.google.com

Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.

View antalyaenyakinlastikci.com Pagerank   Alexa rank for antalyaenyakinlastikci.com 1   website value of antalyaenyakinlastikci.com $ 8,833,062,960.00

Android Apps on Google Play

antalyaenyakinlastikci.com favicon - play.google.com

Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.

View antalyaenyakinlastikci.com Pagerank   Alexa rank for antalyaenyakinlastikci.com 1   website value of antalyaenyakinlastikci.com $ 8,833,062,960.00

Google Chrome - Download the Fast, Secure Browser from Google

antalyaenyakinlastikci.com favicon - chrome.google.com

Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.

View antalyaenyakinlastikci.com Pagerank   Alexa rank for antalyaenyakinlastikci.com 1   website value of antalyaenyakinlastikci.com $ 8,833,062,960.00

Full WHOIS Lookup for antalyaenyakinlastikci.com

Domain Name: ANTALYAENYAKINLASTIKCI.COM
Registry Domain ID: 2394135482_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.isimtescil.net
Registrar URL: http://www.isimtescil.net
Updated Date: 2019-05-23T10:49:18Z
Creation Date: 2019-05-23T08:54:37Z
Registry Expiry Date: 2020-05-23T08:54:37Z
Registrar: FBS Inc.
Registrar IANA ID: 1110
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +90.8502000444
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.WEBSERVERSYSTEMS.COM
Name Server: NS2.WEBSERVERSYSTEMS.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-05-25T18:03:11Z